PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0027s0350.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 322aa    MW: 36566 Da    PI: 5.1053
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0027s0350.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.7e-162673148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  SapurV1A.0027s0350.1.p 26 KGLWSPEEDEKLIKYMLTNGQGCWSDIARNAGLQRCGKSCRLRWINYL 73
                            678*******************************************97 PP

2Myb_DNA-binding52.61.1e-1679123147
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
  SapurV1A.0027s0350.1.p  79 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 123
                             89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.9E-241876IPR009057Homeodomain-like
PROSITE profilePS5129417.5872173IPR017930Myb domain
SuperFamilySSF466897.81E-2924120IPR009057Homeodomain-like
SMARTSM007171.2E-122575IPR001005SANT/Myb domain
PfamPF002491.4E-142673IPR001005SANT/Myb domain
CDDcd001671.72E-102973No hitNo description
PROSITE profilePS5129426.12674128IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.4E-2677128IPR009057Homeodomain-like
SMARTSM007171.8E-1678126IPR001005SANT/Myb domain
PfamPF002492.6E-1579123IPR001005SANT/Myb domain
CDDcd001671.68E-1181124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MRKPDLMGKD RVLPSNSNMN KAKLRKGLWS PEEDEKLIKY MLTNGQGCWS DIARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSILGNR WSQIAARLPG RTDNEIKNFW  120
NSTLKKRLKL NNTSTFSTND SDSSEPRDYA IGNIMPMHDH DIMTLCMDSS SSSSISMQGM  180
VTGNQFDSFS MLNSRYDVTG AASLFDMSTC FTQVGMGDGF YGDHYGILEA TNKTGLALPP  240
LESRSFEEKN TVSNCRIDME SNNNNCSDSI CFNNTDQRFK VEDMLELENH WQGENLRMGE  300
WDFDGFMENI SSFPLLDFQA E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-282412825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00336DAPTransfer from AT3G08500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1486760.0KF148676.1 Populus trichocarpa MYB transcription factor (MYB20) mRNA, complete cds.
GenBankKT2613410.0KT261341.1 Fraxinus mandshurica transcription factor MYB2 (MYB2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025434.10.0PREDICTED: transcription factor MYB46-like
TrEMBLA0A0S3G5C10.0A0A0S3G5C1_9LAMI; Transcription factor MYB2
TrEMBLB9HNP30.0B9HNP3_POPTR; MYB transcription factor
STRINGPOPTR_0009s06630.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.12e-87myb domain protein 83